HORDB

ID: hor002958
Uniprot ID: Q8WN12
Protein name: Prolactin-releasing peptide PrRP20
Gene name: PRLH
Organism: Ovis aries (Sheep)
Family: NA
Source: animal
Expression: More abundantly expressed in the brainstem than the hypothalamus.
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0001894 tissue homeostasis; GO:0002021 response to dietary excess; GO:0006112 energy reserve metabolic process; GO:0006629 lipid metabolic process; GO:0007165 signal transduction; GO:0009749 response to glucose; GO:0032868 response to insulin; GO:0040014 regulation of multicellular organism growth; GO:0042755 eating behavior; GO:0043434 response to peptide hormone; GO:0045444 fat cell differentiation; GO:0048483 autonomic nervous system development
GO CC: GO:0005576 extracellular region

Sequence: TPDINPAWYAGRGIRPVGRF
Length: 20(34-53)
Propeptide: MKAVGAWLLCLLLLGLALQGAASRAHQHSMEIRTPDINPAWYAGRGIRPVGRFGRRRAAPGDGPRPGPRRELACIPLEGGAEPSRALLGRLTAQLVQE
Signal peptide: MKAVGAWLLCLLLLGLALQGAA
Modification: T20 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.
Mechanism: NA
Cross BBB: NA
Target: PRLHR
Target Unid: W5QJ87
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q3E9I4-F1.pdb

hor002958_AF2.pdb

hor002958_ESM.pdb

Mass:	258263	Formula:	C103H155N31O26
Absent amino acids:	CEHKLMQS	Common amino acids:	GPR
pI:	11.05	Basic residues:	3
Polar residues:	6	Hydrophobic residues:	7
Hydrophobicity:	-49	Boman Index:	-3720
Half-Life:	7.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	63.5
Instability Index:	3228.5	Extinction Coefficient cystines:	6990
Absorbance 280nm:	367.89